Lineage for d1jumb1 (1jum B:2-72)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 150008Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)
  6. 150009Protein Multidrug binding protein QacR [68964] (1 species)
  7. 150010Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries)
  8. 150028Domain d1jumb1: 1jum B:2-72 [67306]
    Other proteins in same PDB: d1juma2, d1jumb2, d1jumd2, d1jume2

Details for d1jumb1

PDB Entry: 1jum (more details), 2.98 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine

SCOP Domain Sequences for d1jumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jumb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jumb1:

Click to download the PDB-style file with coordinates for d1jumb1.
(The format of our PDB-style files is described here.)

Timeline for d1jumb1: