SCOPe 2.06: Domain d1juma2: 1jum A:73-187

Lineage for d1juma2 (1jum A:73-187)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d1juma2: 1jum A:73-187 [67305]
   Other proteins in same PDB: d1juma1, d1jumb1, d1jumd1, d1jume1
   complexed with ber, so4

Details for d1juma2

PDB Entry: 1jum, 2.98 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine

PDB Compounds: (A:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1juma2:

Sequence; same for both SEQRES and ATOM records:

>d1juma2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1juma2:

• d1juma2 first appeared in SCOP 1.59
  
• d1juma2 appears in SCOPe 2.05
  
• d1juma2 appears in SCOPe 2.07
  
• d1juma2 appears in the current release, SCOPe 2.08