Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (3 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries) |
Domain d1jtye1: 1jty E:2-72 [67298] Other proteins in same PDB: d1jtya2, d1jtyb2, d1jtyd2, d1jtye2 complexed with et, so4; mutant |
PDB Entry: 1jty (more details), 2.97 Å
SCOP Domain Sequences for d1jtye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtye1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
Timeline for d1jtye1: