Lineage for d1jtye1 (1jty E:2-72)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277756Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (3 proteins)
  6. 277763Protein Multidrug binding protein QacR [68964] (1 species)
  7. 277764Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries)
  8. 277780Domain d1jtye1: 1jty E:2-72 [67298]
    Other proteins in same PDB: d1jtya2, d1jtyb2, d1jtyd2, d1jtye2
    complexed with et, so4; mutant

Details for d1jtye1

PDB Entry: 1jty (more details), 2.97 Å

PDB Description: crystal structure of the multidrug binding transcriptional regulator qacr bound to ethidium

SCOP Domain Sequences for d1jtye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtye1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jtye1:

Click to download the PDB-style file with coordinates for d1jtye1.
(The format of our PDB-style files is described here.)

Timeline for d1jtye1: