Lineage for d1jtyb2 (1jty B:73-187)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2334824Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2334825Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2334905Domain d1jtyb2: 1jty B:73-187 [67295]
    Other proteins in same PDB: d1jtya1, d1jtyb1, d1jtyd1, d1jtye1
    complexed with et, so4

Details for d1jtyb2

PDB Entry: 1jty (more details), 2.97 Å

PDB Description: Crystal structure of the multidrug binding transcriptional regulator QacR bound to ethidium
PDB Compounds: (B:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jtyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtyb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d1jtyb2:

Click to download the PDB-style file with coordinates for d1jtyb2.
(The format of our PDB-style files is described here.)

Timeline for d1jtyb2: