Lineage for d1jtxa2 (1jtx A:73-187)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156164Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
  4. 156165Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 156166Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 156167Protein Multidrug binding protein QacR [69107] (1 species)
  7. 156168Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)
  8. 156173Domain d1jtxa2: 1jtx A:73-187 [67285]
    Other proteins in same PDB: d1jtxa1, d1jtxb1, d1jtxd1, d1jtxe1

Details for d1jtxa2

PDB Entry: 1jtx (more details), 2.85 Å

PDB Description: Crystal structure of the multidrug binding transcriptional regulator QacR bound to crystal violet

SCOP Domain Sequences for d1jtxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtxa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1jtxa2:

Click to download the PDB-style file with coordinates for d1jtxa2.
(The format of our PDB-style files is described here.)

Timeline for d1jtxa2: