Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries) |
Domain d1jtta_: 1jtt A: [67282] Other proteins in same PDB: d1jttl_ |
PDB Entry: 1jtt (more details), 2.1 Å
SCOP Domain Sequences for d1jtta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtta_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody} dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy dswgqgtqvtvss
Timeline for d1jtta_: