Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries) |
Domain d1jtpl_: 1jtp L: [67280] Other proteins in same PDB: d1jtpa_, d1jtpb_ complexed with fmt, na |
PDB Entry: 1jtp (more details), 1.9 Å
SCOPe Domain Sequences for d1jtpl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtpl_ d.2.1.2 (L:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]} kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv hawirgcrl
Timeline for d1jtpl_: