Lineage for d1jtpa_ (1jtp A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755462Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1755463Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 1755478Domain d1jtpa_: 1jtp A: [67278]
    Other proteins in same PDB: d1jtpl_, d1jtpm_
    anti-lysozyme VHh domain
    complexed with fmt, na

Details for d1jtpa_

PDB Entry: 1jtp (more details), 1.9 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (A:) Single-Domain Antibody

SCOPe Domain Sequences for d1jtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtpa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
dswgqgtqvtvssrr

SCOPe Domain Coordinates for d1jtpa_:

Click to download the PDB-style file with coordinates for d1jtpa_.
(The format of our PDB-style files is described here.)

Timeline for d1jtpa_: