SCOPe 2.04: Domain d1jtpa_: 1jtp A:

Lineage for d1jtpa_ (1jtp A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1jtpa_: 1jtp A: [67278]
   Other proteins in same PDB: d1jtpl_, d1jtpm_
   anti-lysozyme VHh domain
   complexed with fmt, na

Details for d1jtpa_

PDB Entry: 1jtp, 1.9 Å

PDB Description: degenerate interfaces in antigen-antibody complexes

PDB Compounds: (A:) Single-Domain Antibody

SCOPe Domain Sequences for d1jtpa_:

Sequence; same for both SEQRES and ATOM records:

>d1jtpa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
dswgqgtqvtvssrr

Timeline for d1jtpa_:

• d1jtpa_ first appeared in SCOP 1.59
  
• d1jtpa_ appears in SCOPe 2.03
  
• d1jtpa_ appears in SCOPe 2.05
  
• d1jtpa_ appears in the current release, SCOPe 2.08