Lineage for d1jtpa_ (1jtp A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157711Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries)
  8. 157712Domain d1jtpa_: 1jtp A: [67278]
    Other proteins in same PDB: d1jtpl_, d1jtpm_

Details for d1jtpa_

PDB Entry: 1jtp (more details), 1.9 Å

PDB Description: degenerate interfaces in antigen-antibody complexes
PDB Compounds: (A:)

SCOP Domain Sequences for d1jtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtpa_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody}
dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
dswgqgtqvtvssrr

SCOP Domain Coordinates for d1jtpa_:

Click to download the PDB-style file with coordinates for d1jtpa_.
(The format of our PDB-style files is described here.)

Timeline for d1jtpa_: