Lineage for d1jtob_ (1jto B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157711Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries)
  8. 157716Domain d1jtob_: 1jto B: [67275]
    Other proteins in same PDB: d1jtol_, d1jtom_

Details for d1jtob_

PDB Entry: 1jto (more details), 2.5 Å

PDB Description: degenerate interfaces in antigen-antibody complexes

SCOP Domain Sequences for d1jtob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtob_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOP Domain Coordinates for d1jtob_:

Click to download the PDB-style file with coordinates for d1jtob_.
(The format of our PDB-style files is described here.)

Timeline for d1jtob_: