Lineage for d1jtda_ (1jtd A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618634Protein beta-Lactamase, class A [56606] (16 species)
  7. 2618665Species Escherichia coli, TEM-1 [TaxId:562] [56607] (62 PDB entries)
  8. 2618730Domain d1jtda_: 1jtd A: [67264]
    Other proteins in same PDB: d1jtdb_
    complexed with ca

Details for d1jtda_

PDB Entry: 1jtd (more details), 2.3 Å

PDB Description: Crystal structure of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase
PDB Compounds: (A:) tem-1 beta-lactamase

SCOPe Domain Sequences for d1jtda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtda_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda
gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk
eltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqq
lidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgs
qatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1jtda_:

Click to download the PDB-style file with coordinates for d1jtda_.
(The format of our PDB-style files is described here.)

Timeline for d1jtda_: