Lineage for d1jtda_ (1jtd A:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517302Protein beta-Lactamase, class A [56606] (15 species)
  7. 517317Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)
  8. 517344Domain d1jtda_: 1jtd A: [67264]
    Other proteins in same PDB: d1jtdb_

Details for d1jtda_

PDB Entry: 1jtd (more details), 2.3 Å

PDB Description: Crystal structure of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase

SCOP Domain Sequences for d1jtda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtda_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda
gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk
eltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqq
lidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgs
qatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1jtda_:

Click to download the PDB-style file with coordinates for d1jtda_.
(The format of our PDB-style files is described here.)

Timeline for d1jtda_: