![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) |
![]() | Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins) |
![]() | Protein beta-Lactamase, class A [56606] (13 species) |
![]() | Species Escherichia coli, TEM-1 [TaxId:562] [56607] (21 PDB entries) |
![]() | Domain d1jtda_: 1jtd A: [67264] Other proteins in same PDB: d1jtdb_ complexed with ca |
PDB Entry: 1jtd (more details), 2.3 Å
SCOP Domain Sequences for d1jtda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtda_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1} petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk eltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqq lidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgs qatmdernrqiaeigaslikhw
Timeline for d1jtda_: