Lineage for d1jtda_ (1jtd A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) Species Escherichia coli, TEM-1 [TaxId:562] [56607] (13 PDB entries) 
Domain d1jtda_: 1jtd A: [67264]
Other proteins in same PDB: d1jtdb_
Details for d1jtda_
PDB Entry: 1jtd (more details), 2.3 Å
PDB Description: Crystal structure of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase
SCOP Domain Sequences for d1jtda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtda_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda
gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk
eltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqq
lidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgs
qatmdernrqiaeigaslikhw
SCOP Domain Coordinates for d1jtda_:
Click to download the PDB-style file with coordinates for d1jtda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtda_:
- d1jtda_ is new in SCOP 1.59
- d1jtda_ appears in SCOP 1.61
- d1jtda_ appears in the current release, SCOPe 2.08
View in 3D
