Lineage for d1jtcd1 (1jtc D:1G-137)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061460Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2061474Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2061507Domain d1jtcd1: 1jtc D:1G-137 [67263]
    Other proteins in same PDB: d1jtca2, d1jtcb2, d1jtcc2, d1jtcd2
    complexed with fmt

Details for d1jtcd1

PDB Entry: 1jtc (more details), 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe (l44f)
PDB Compounds: (D:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jtcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtcd1 b.42.1.1 (D:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
prthygqkailflplpv

SCOPe Domain Coordinates for d1jtcd1:

Click to download the PDB-style file with coordinates for d1jtcd1.
(The format of our PDB-style files is described here.)

Timeline for d1jtcd1: