Lineage for d1jtcb_ (1jtc B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316303Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1316304Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1316305Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1316319Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1316350Domain d1jtcb_: 1jtc B: [67261]
    complexed with fmt

Details for d1jtcb_

PDB Entry: 1jtc (more details), 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe (l44f)
PDB Compounds: (B:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jtcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtcb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

SCOPe Domain Coordinates for d1jtcb_:

Click to download the PDB-style file with coordinates for d1jtcb_.
(The format of our PDB-style files is described here.)

Timeline for d1jtcb_: