SCOP 1.59: Domain d1jtcb_: 1jtc B:

Lineage for d1jtcb_ (1jtc B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)

8. Domain d1jtcb_: 1jtc B: [67261]

Details for d1jtcb_

PDB Entry: 1jtc, 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe (l44f)

SCOP Domain Sequences for d1jtcb_:

Sequence; same for both SEQRES and ATOM records:

>d1jtcb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

Timeline for d1jtcb_:

• d1jtcb_ is new in SCOP 1.59
  
• d1jtcb_ appears in SCOP 1.61
  
• d1jtcb_ appears in the current release, SCOPe 2.08, called d1jtcb1