SCOP 1.65: Domain d1jtca_: 1jtc A:

Lineage for d1jtca_ (1jtc A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)

8. Domain d1jtca_: 1jtc A: [67260]

Details for d1jtca_

PDB Entry: 1jtc, 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe (l44f)

SCOP Domain Sequences for d1jtca_:

Sequence; same for both SEQRES and ATOM records:

>d1jtca_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

Timeline for d1jtca_:

• d1jtca_ first appeared in SCOP 1.59
  
• d1jtca_ appears in SCOP 1.63
  
• d1jtca_ appears in SCOP 1.67
  
• d1jtca_ appears in the current release, SCOPe 2.08, called d1jtca1