Lineage for d1jt9a_ (1jt9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2150965Family c.124.1.1: NagB-like [52513] (3 protein domains)
    share a common phosphate-binding site with the RpiA family
  6. 2150970Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 2150971Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 2150973Domain d1jt9a_: 1jt9 A: [67259]
    mutant

Details for d1jt9a_

PDB Entry: 1jt9 (more details), 2.06 Å

PDB Description: structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d1jt9a_:

Sequence, based on SEQRES records: (download)

>d1jt9a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrfadndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Sequence, based on observed residues (ATOM records): (download)

>d1jt9a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlpkyaltvgvgtlldaeev
milvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcdepstmelkvktlryfnele
aenikgl

SCOPe Domain Coordinates for d1jt9a_:

Click to download the PDB-style file with coordinates for d1jt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jt9a_: