Lineage for d1jt7c_ (1jt7 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790653Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1790654Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1790668Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1790712Domain d1jt7c_: 1jt7 C: [67257]
    complexed with fmt, so4

Details for d1jt7c_

PDB Entry: 1jt7 (more details), 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe and leu 73 replaced by val and val 109 replaced by leu (l44f/l73v/v109l)
PDB Compounds: (C:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jt7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt7c_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkngs
ckrgprthygqkailflplpv

SCOPe Domain Coordinates for d1jt7c_:

Click to download the PDB-style file with coordinates for d1jt7c_.
(The format of our PDB-style files is described here.)

Timeline for d1jt7c_: