Lineage for d1jt7c_ (1jt7 C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298064Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 298065Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)
  6. 298066Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 298080Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)
  8. 298089Domain d1jt7c_: 1jt7 C: [67257]

Details for d1jt7c_

PDB Entry: 1jt7 (more details), 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe and leu 73 replaced by val and val 109 replaced by leu (l44f/l73v/v109l)

SCOP Domain Sequences for d1jt7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt7c_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkngs
ckrgprthygqkailflplpv

SCOP Domain Coordinates for d1jt7c_:

Click to download the PDB-style file with coordinates for d1jt7c_.
(The format of our PDB-style files is described here.)

Timeline for d1jt7c_: