SCOP 1.59: Domain d1jt7b_: 1jt7 B:

Lineage for d1jt7b_ (1jt7 B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)

8. Domain d1jt7b_: 1jt7 B: [67256]

Details for d1jt7b_

PDB Entry: 1jt7, 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe and leu 73 replaced by val and val 109 replaced by leu (l44f/l73v/v109l)

SCOP Domain Sequences for d1jt7b_:

Sequence; same for both SEQRES and ATOM records:

>d1jt7b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
sckrgprthygqkailflplpv

Timeline for d1jt7b_:

• d1jt7b_ is new in SCOP 1.59
  
• d1jt7b_ appears in SCOP 1.61
  
• d1jt7b_ appears in the current release, SCOPe 2.08, called d1jt7b1