SCOPe 2.08: Domain d1jt7a1: 1jt7 A:1G-137

Lineage for d1jt7a1 (1jt7 A:1G-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1jt7a1: 1jt7 A:1G-137 [67255]
   Other proteins in same PDB: d1jt7a2, d1jt7b2, d1jt7c2, d1jt7d2
   complexed with fmt, so4

Details for d1jt7a1

PDB Entry: 1jt7, 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe and leu 73 replaced by val and val 109 replaced by leu (l44f/l73v/v109l)

PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jt7a1:

Sequence; same for both SEQRES and ATOM records:

>d1jt7a1 b.42.1.1 (A:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikste
tgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkngsckrg
prthygqkailflplpv

Timeline for d1jt7a1:

• d1jt7a1 first appeared in SCOP 1.59, called d1jt7a_
  
• d1jt7a1 appears in SCOPe 2.07