SCOPe 2.05: Domain d1jt6e2: 1jt6 E:73-187

Lineage for d1jt6e2 (1jt6 E:73-187)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d1jt6e2: 1jt6 E:73-187 [67254]
   Other proteins in same PDB: d1jt6a1, d1jt6b1, d1jt6d1, d1jt6e1
   complexed with deq, so4

Details for d1jt6e2

PDB Entry: 1jt6, 2.54 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to dequalinium

PDB Compounds: (E:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jt6e2:

Sequence; same for both SEQRES and ATOM records:

>d1jt6e2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1jt6e2:

• d1jt6e2 first appeared in SCOP 1.59
  
• d1jt6e2 appears in SCOPe 2.04
  
• d1jt6e2 appears in SCOPe 2.06
  
• d1jt6e2 appears in the current release, SCOPe 2.08