Lineage for d1jt6e2 (1jt6 E:73-187)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217395Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 217396Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 217397Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 217398Protein Multidrug binding protein QacR [69107] (1 species)
  7. 217399Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)
  8. 217403Domain d1jt6e2: 1jt6 E:73-187 [67254]
    Other proteins in same PDB: d1jt6a1, d1jt6b1, d1jt6d1, d1jt6e1
    complexed with deq, so4; mutant

Details for d1jt6e2

PDB Entry: 1jt6 (more details), 2.54 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to dequalinium

SCOP Domain Sequences for d1jt6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt6e2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1jt6e2:

Click to download the PDB-style file with coordinates for d1jt6e2.
(The format of our PDB-style files is described here.)

Timeline for d1jt6e2: