Lineage for d1jt6b2 (1jt6 B:73-187)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100882Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
  4. 100883Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 100884Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 100885Protein Multidrug binding protein QacR [69107] (1 species)
  7. 100886Species Staphylococcus aureus [TaxId:1280] [69108] (6 PDB entries)
  8. 100888Domain d1jt6b2: 1jt6 B:73-187 [67250]
    Other proteins in same PDB: d1jt6a1, d1jt6b1, d1jt6d1, d1jt6e1

Details for d1jt6b2

PDB Entry: 1jt6 (more details), 2.54 Å

PDB Description: Crystal structure of the multidrug binding protein QacR bound to dequalinium

SCOP Domain Sequences for d1jt6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt6b2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1jt6b2:

Click to download the PDB-style file with coordinates for d1jt6b2.
(The format of our PDB-style files is described here.)

Timeline for d1jt6b2: