SCOP 1.59: Domain d1jt6b1: 1jt6 B:2-72

Lineage for d1jt6b1 (1jt6 B:2-72)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (6 PDB entries)

8. Domain d1jt6b1: 1jt6 B:2-72 [67249]
   Other proteins in same PDB: d1jt6a2, d1jt6b2, d1jt6d2, d1jt6e2

Details for d1jt6b1

PDB Entry: 1jt6, 2.54 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to dequalinium

SCOP Domain Sequences for d1jt6b1:

Sequence; same for both SEQRES and ATOM records:

>d1jt6b1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d1jt6b1:

• d1jt6b1 is new in SCOP 1.59
  
• d1jt6b1 appears in SCOP 1.61
  
• d1jt6b1 appears in the current release, SCOPe 2.08