Lineage for d1jt5a_ (1jt5 A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins) 
Protein Acidic FGF (FGF1) [50357] (3 species) Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries) 
Domain d1jt5a_: 1jt5 A: [67245]
Details for d1jt5a_
PDB Entry: 1jt5 (more details), 1.85 Å
PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 73 replaced by val and val 109 replaced by leu (l73v/v109l)
SCOP Domain Sequences for d1jt5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt5a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
sckrgprthygqkailflplpv
SCOP Domain Coordinates for d1jt5a_:
Click to download the PDB-style file with coordinates for d1jt5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jt5a_:
- d1jt5a_ is new in SCOP 1.59
- d1jt5a_ appears in SCOP 1.61
- d1jt5a_ appears in the current release, SCOPe 2.08, called d1jt5a1
View in 3D
