| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
| Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
| Protein Acidic FGF (FGF1) [50357] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries) Uniprot P05230 16-152 ! Uniprot P05230 |
| Domain d1jt4b1: 1jt4 B:1G-137 [67244] Other proteins in same PDB: d1jt4a2, d1jt4b2 complexed with fmt |
PDB Entry: 1jt4 (more details), 1.78 Å
SCOPe Domain Sequences for d1jt4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt4b1 b.42.1.1 (B:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwflglkkngsckrg
prthygqkailflplpv
Timeline for d1jt4b1: