Lineage for d1jt3b_ (1jt3 B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetrySuperfamily b.42.1: Cytokine [50353] (3 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) Protein Acidic FGF (FGF1) [50357] (4 species) Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
Uniprot P05230 16-152 ! Uniprot P05230
Domain d1jt3b_: 1jt3 B: [67242]
complexed with so4
Details for d1jt3b_
PDB Entry: 1jt3 (more details), 1.95 Å
PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino histidine tag and leu 73 replaced by val (l73v)
PDB Compounds: (B:) acidic fibroblast growth factorSCOPe Domain Sequences for d1jt3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt3b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
sckrgprthygqkailflplpv
SCOPe Domain Coordinates for d1jt3b_:
Click to download the PDB-style file with coordinates for d1jt3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jt3b_:
- d1jt3b_ first appeared in SCOP 1.59
- d1jt3b_ appears in SCOPe 2.04
- d1jt3b_ is called d1jt3b1 in SCOPe 2.06
- d1jt3b_ appears in the current release, SCOPe 2.08, called d1jt3b1
View in 3D
