SCOPe 2.03: Domain d1jt3b_: 1jt3 B:

Lineage for d1jt3b_ (1jt3 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1jt3b_: 1jt3 B: [67242]
   complexed with so4

Details for d1jt3b_

PDB Entry: 1jt3, 1.95 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino histidine tag and leu 73 replaced by val (l73v)

PDB Compounds: (B:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jt3b_:

Sequence; same for both SEQRES and ATOM records:

>d1jt3b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
sckrgprthygqkailflplpv

Timeline for d1jt3b_:

• d1jt3b_ first appeared in SCOP 1.59
  
• d1jt3b_ appears in SCOPe 2.02
  
• d1jt3b_ appears in SCOPe 2.04
  
• d1jt3b_ appears in the current release, SCOPe 2.08, called d1jt3b1