Lineage for d1jskb_ (1jsk B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198918Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 198924Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)
  8. 198927Domain d1jskb_: 1jsk B: [67231]
    Other proteins in same PDB: d1jskc_

Details for d1jskb_

PDB Entry: 1jsk (more details), 3.5 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d

SCOP Domain Sequences for d1jskb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jskb_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Mouse (Mus musculus)}
gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
rav

SCOP Domain Coordinates for d1jskb_:

Click to download the PDB-style file with coordinates for d1jskb_.
(The format of our PDB-style files is described here.)

Timeline for d1jskb_: