SCOP 1.61: Domain d1jscb2: 1jsc B:82-272

Lineage for d1jscb2 (1jsc B:82-272)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)

6. Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (1 PDB entry)

8. Domain d1jscb2: 1jsc B:82-272 [67228]
   Other proteins in same PDB: d1jsca1, d1jscb1

Details for d1jscb2

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jscb2:

Sequence; same for both SEQRES and ATOM records:

>d1jscb2 c.36.1.1 (B:82-272) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
epdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqg
aghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdaf
qeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnp
iptkttlpsna

Timeline for d1jscb2:

• d1jscb2 first appeared in SCOP 1.59
  
• d1jscb2 appears in SCOP 1.63
  
• d1jscb2 appears in the current release, SCOPe 2.08