Lineage for d1jscb1 (1jsc B:276-458)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121415Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 121416Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 121428Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins)
  6. 121429Protein Acetohydroxyacid synthase catalytic subunit [69463] (1 species)
  7. 121430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (1 PDB entry)
  8. 121432Domain d1jscb1: 1jsc B:276-458 [67227]
    Other proteins in same PDB: d1jsca2, d1jsca3, d1jscb2, d1jscb3

Details for d1jscb1

PDB Entry: 1jsc (more details), 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jscb1:

Sequence, based on SEQRES records: (download)

>d1jscb1 c.31.1.3 (B:276-458) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
ltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttl
qglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearra
aaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwk
key

Sequence, based on observed residues (ATOM records): (download)

>d1jscb1 c.31.1.3 (B:276-458) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
ltsraqdefvmqsinkaadlinlakpvlyvgagilnhadgprllkelsdraqipvtttlq
glgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraa
iihfevspkninkvvqtqiavegdattnlgkmmskifpvrsewfaqinkwkkey

SCOP Domain Coordinates for d1jscb1:

Click to download the PDB-style file with coordinates for d1jscb1.
(The format of our PDB-style files is described here.)

Timeline for d1jscb1: