SCOP 1.67: Domain d1jsca3: 1jsc A:461-648

Lineage for d1jsca3 (1jsc A:461-648)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (2 PDB entries)

8. Domain d1jsca3: 1jsc A:461-648 [67226]
   Other proteins in same PDB: d1jsca1, d1jsca2, d1jscb1, d1jscb2

Details for d1jsca3

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca3:

Sequence, based on SEQRES records:

>d1jsca3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkk

Sequence, based on observed residues (ATOM records):

>d1jsca3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnnees
hthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk

Timeline for d1jsca3:

• d1jsca3 first appeared in SCOP 1.59
  
• d1jsca3 appears in SCOP 1.65
  
• d1jsca3 appears in SCOP 1.69
  
• d1jsca3 appears in the current release, SCOPe 2.08