SCOP 1.59: Domain d1jsca3: 1jsc A:461-648

Lineage for d1jsca3 (1jsc A:461-648)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)

6. Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (1 PDB entry)

8. Domain d1jsca3: 1jsc A:461-648 [67226]
   Other proteins in same PDB: d1jsca1, d1jscb1

Details for d1jsca3

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca3:

Sequence, based on SEQRES records:

>d1jsca3 c.36.1.1 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkk

Sequence, based on observed residues (ATOM records):

>d1jsca3 c.36.1.1 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnnees
hthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk

Timeline for d1jsca3:

• d1jsca3 is new in SCOP 1.59
  
• d1jsca3 appears in SCOP 1.61
  
• d1jsca3 appears in the current release, SCOPe 2.08