SCOP 1.67: Domain d1jsca2: 1jsc A:83-270

Lineage for d1jsca2 (1jsc A:83-270)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (2 PDB entries)

8. Domain d1jsca2: 1jsc A:83-270 [67225]
   Other proteins in same PDB: d1jsca1, d1jsca3, d1jscb1, d1jscb3

Details for d1jsca2

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca2:

Sequence; same for both SEQRES and ATOM records:

>d1jsca2 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

Timeline for d1jsca2:

• d1jsca2 first appeared in SCOP 1.59
  
• d1jsca2 appears in SCOP 1.65
  
• d1jsca2 appears in SCOP 1.69
  
• d1jsca2 appears in the current release, SCOPe 2.08