Lineage for d1jsca2 (1jsc A:83-270)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121564Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)
  6. 121565Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species)
  7. 121566Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (1 PDB entry)
  8. 121567Domain d1jsca2: 1jsc A:83-270 [67225]
    Other proteins in same PDB: d1jsca1, d1jscb1

Details for d1jsca2

PDB Entry: 1jsc (more details), 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsca2 c.36.1.1 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

SCOP Domain Coordinates for d1jsca2:

Click to download the PDB-style file with coordinates for d1jsca2.
(The format of our PDB-style files is described here.)

Timeline for d1jsca2: