Lineage for d1jsca1 (1jsc A:280-460)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580740Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 580741Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 580764Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 580765Protein Acetohydroxyacid synthase catalytic subunit [69463] (1 species)
  7. 580766Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (6 PDB entries)
  8. 580777Domain d1jsca1: 1jsc A:280-460 [67224]
    Other proteins in same PDB: d1jsca2, d1jsca3, d1jscb2, d1jscb3

Details for d1jsca1

PDB Entry: 1jsc (more details), 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsca1 c.31.1.3 (A:280-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglg
sfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaeg
rggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeyp
y

SCOP Domain Coordinates for d1jsca1:

Click to download the PDB-style file with coordinates for d1jsca1.
(The format of our PDB-style files is described here.)

Timeline for d1jsca1: