SCOP 1.61: Domain d1js8b2: 1js8 B:2792-2892

Lineage for d1js8b2 (1js8 B:2792-2892)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein C-terminal domain of octopus hemocyanin [69165] (1 species)

7. Species Giant octopus (Octopus dofleini) [TaxId:267067] [69166] (1 PDB entry)

8. Domain d1js8b2: 1js8 B:2792-2892 [67222]
   Other proteins in same PDB: d1js8a1, d1js8b1

Details for d1js8b2

PDB Entry: 1js8, 2.3 Å

PDB Description: structure of a functional unit from octopus hemocyanin

SCOP Domain Sequences for d1js8b2:

Sequence; same for both SEQRES and ATOM records:

>d1js8b2 b.1.1.5 (B:2792-2892) C-terminal domain of octopus hemocyanin {Giant octopus (Octopus dofleini)}
edrvfagfllrtigqsadvnfdvctkdgectfggtfcilggehemfwafdrlfkyditts
lkhlrldahddfdikvtikgidghvlsnkylspptvflapa

Timeline for d1js8b2:

• d1js8b2 first appeared in SCOP 1.59
  
• d1js8b2 appears in SCOP 1.63
  
• d1js8b2 appears in the current release, SCOPe 2.08