Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.5: E set domains [49208] (25 proteins) |
Protein C-terminal domain of octopus hemocyanin [69165] (1 species) |
Species Giant octopus (Octopus dofleini) [TaxId:267067] [69166] (1 PDB entry) |
Domain d1js8b2: 1js8 B:2792-2892 [67222] Other proteins in same PDB: d1js8a1, d1js8b1 |
PDB Entry: 1js8 (more details), 2.3 Å
SCOP Domain Sequences for d1js8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1js8b2 b.1.1.5 (B:2792-2892) C-terminal domain of octopus hemocyanin {Giant octopus (Octopus dofleini)} edrvfagfllrtigqsadvnfdvctkdgectfggtfcilggehemfwafdrlfkyditts lkhlrldahddfdikvtikgidghvlsnkylspptvflapa
Timeline for d1js8b2: