| Class b: All beta proteins [48724] (180 folds) |
| Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily) six-stranded beta-sandwich, jelly-roll/greek-key topology |
Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family) ![]() analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain |
| Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein) |
| Protein C-terminal domain of mollusc hemocyanin [69165] (2 species) |
| Species Giant octopus (Octopus dofleini) [TaxId:267067] [69166] (1 PDB entry) |
| Domain d1js8b2: 1js8 B:2792-2892 [67222] Other proteins in same PDB: d1js8a1, d1js8b1 complexed with cuo, man |
PDB Entry: 1js8 (more details), 2.3 Å
SCOPe Domain Sequences for d1js8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1js8b2 b.112.1.1 (B:2792-2892) C-terminal domain of mollusc hemocyanin {Giant octopus (Octopus dofleini) [TaxId: 267067]}
edrvfagfllrtigqsadvnfdvctkdgectfggtfcilggehemfwafdrlfkyditts
lkhlrldahddfdikvtikgidghvlsnkylspptvflapa
Timeline for d1js8b2: