SCOP 1.73: Domain d1js8a2: 1js8 A:2792-2892

Lineage for d1js8a2 (1js8 A:2792-2892)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily)
   six-stranded beta-sandwich, jelly-roll/greek-key topology

4. Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family)
   analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain

5. Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein)

6. Protein C-terminal domain of mollusc hemocyanin [69165] (2 species)

7. Species Giant octopus (Octopus dofleini) [TaxId:267067] [69166] (1 PDB entry)

8. Domain d1js8a2: 1js8 A:2792-2892 [67220]
   Other proteins in same PDB: d1js8a1, d1js8b1

Details for d1js8a2

PDB Entry: 1js8, 2.3 Å

PDB Description: structure of a functional unit from octopus hemocyanin

PDB Compounds: (A:) Hemocyanin

SCOP Domain Sequences for d1js8a2:

Sequence; same for both SEQRES and ATOM records:

>d1js8a2 b.112.1.1 (A:2792-2892) C-terminal domain of mollusc hemocyanin {Giant octopus (Octopus dofleini) [TaxId: 6644]}
edrvfagfllrtigqsadvnfdvctkdgectfggtfcilggehemfwafdrlfkyditts
lkhlrldahddfdikvtikgidghvlsnkylspptvflapa

Timeline for d1js8a2:

• d1js8a2 first appeared in SCOP 1.59
  
• d1js8a2 appears in SCOP 1.71
  
• d1js8a2 appears in SCOP 1.75
  
• d1js8a2 appears in the current release, SCOPe 2.08