Lineage for d1js8a2 (1js8 A:2792-2892)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821177Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily)
    six-stranded beta-sandwich, jelly-roll/greek-key topology
  4. 2821178Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family) (S)
    analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain
  5. 2821179Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein)
  6. 2821180Protein C-terminal domain of mollusc hemocyanin [69165] (2 species)
  7. 2821181Species Giant octopus (Octopus dofleini) [TaxId:267067] [69166] (1 PDB entry)
  8. 2821182Domain d1js8a2: 1js8 A:2792-2892 [67220]
    Other proteins in same PDB: d1js8a1, d1js8b1
    complexed with cuo, man

Details for d1js8a2

PDB Entry: 1js8 (more details), 2.3 Å

PDB Description: structure of a functional unit from octopus hemocyanin
PDB Compounds: (A:) Hemocyanin

SCOPe Domain Sequences for d1js8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js8a2 b.112.1.1 (A:2792-2892) C-terminal domain of mollusc hemocyanin {Giant octopus (Octopus dofleini) [TaxId: 267067]}
edrvfagfllrtigqsadvnfdvctkdgectfggtfcilggehemfwafdrlfkyditts
lkhlrldahddfdikvtikgidghvlsnkylspptvflapa

SCOPe Domain Coordinates for d1js8a2:

Click to download the PDB-style file with coordinates for d1js8a2.
(The format of our PDB-style files is described here.)

Timeline for d1js8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1js8a1