Lineage for d1js8a1 (1js8 A:2503-2791)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002036Family a.86.1.1: Hemocyanin middle domain [48057] (2 protein domains)
  6. 2002051Protein Mollusc hemocyanin [69079] (2 species)
  7. 2002052Species Giant octopus (Octopus dofleini) [TaxId:267067] [69080] (1 PDB entry)
  8. 2002053Domain d1js8a1: 1js8 A:2503-2791 [67219]
    Other proteins in same PDB: d1js8a2, d1js8b2
    complexed with cuo, man

Details for d1js8a1

PDB Entry: 1js8 (more details), 2.3 Å

PDB Description: structure of a functional unit from octopus hemocyanin
PDB Compounds: (A:) Hemocyanin

SCOPe Domain Sequences for d1js8a1:

Sequence, based on SEQRES records: (download)

>d1js8a1 a.86.1.1 (A:2503-2791) Mollusc hemocyanin {Giant octopus (Octopus dofleini) [TaxId: 267067]}
aiirknvnsltpsdikelrdamakvqadtsdngyqkiasyhgiplschyengtayaccqh
gmvtfpnwhrlltkqmedalvakgshvgipywdwtttfanlpvlvteekdnsfhhahidv
antdttrspraqlfddpdkgdksffyrqialaleqtdfcdfeiqfeighnaihswvggss
pygmstlhytsydplfylhhsntdriwsvwqalqkyrglpyntanceinklvkplkpfnl
dtnpnavtkahstgatsfdyhklgydydnlnfhgmtipeleehlkeiqh

Sequence, based on observed residues (ATOM records): (download)

>d1js8a1 a.86.1.1 (A:2503-2791) Mollusc hemocyanin {Giant octopus (Octopus dofleini) [TaxId: 267067]}
aiirknvnsltpsdikelrdamakvqadtsdngyqkiasyhgiplschyengtayaccqh
gmvtfpnwhrlltkqmedalvakgshvgipywdwtttfanlpvlvteekdnsfhhahidv
antdttrspraqlfsffyrqialaleqtdfcdfeiqfeighnaihswvggsspygmstlh
ytsydplfylhhsntdriwsvwqalqkyrglpyntanceinklvkplkpfnldtnpnavt
kahstgatsfdyhklgydydnlnfhgmtipeleehlkeiqh

SCOPe Domain Coordinates for d1js8a1:

Click to download the PDB-style file with coordinates for d1js8a1.
(The format of our PDB-style files is described here.)

Timeline for d1js8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1js8a2