Lineage for d1js6b_ (1js6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132106Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 protein domains)
    automatically mapped to Pfam PF00282
  6. 2132107Protein DOPA decarboxylase [69566] (1 species)
  7. 2132108Species Pig (Sus scrofa) [TaxId:9823] [69567] (2 PDB entries)
  8. 2132112Domain d1js6b_: 1js6 B: [67218]
    complexed with plp

Details for d1js6b_

PDB Entry: 1js6 (more details), 2.6 Å

PDB Description: Crystal Structure of DOPA decarboxylase
PDB Compounds: (B:) DOPA decarboxylase

SCOPe Domain Sequences for d1js6b_:

Sequence, based on SEQRES records: (download)

>d1js6b_ c.67.1.6 (B:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]}
mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella

Sequence, based on observed residues (ATOM records): (download)

>d1js6b_ c.67.1.6 (B:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]}
mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella

SCOPe Domain Coordinates for d1js6b_:

Click to download the PDB-style file with coordinates for d1js6b_.
(The format of our PDB-style files is described here.)

Timeline for d1js6b_: