Lineage for d1js6a_ (1js6 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 126165Family c.67.1.6: DOPA decarboxylase [69565] (1 protein)
  6. 126166Protein DOPA decarboxylase [69566] (1 species)
  7. 126167Species Pig (Sus scrofa) [TaxId:9823] [69567] (2 PDB entries)
  8. 126170Domain d1js6a_: 1js6 A: [67217]

Details for d1js6a_

PDB Entry: 1js6 (more details), 2.6 Å

PDB Description: Crystal Structure of DOPA decarboxylase

SCOP Domain Sequences for d1js6a_:

Sequence, based on SEQRES records: (download)

>d1js6a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa)}
mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
phkwllvnfdcsamwvkrrtdltgafkldpvylkhshqgsglitdyrhwqlplgrrfrsl
kmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdgln
eallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella

Sequence, based on observed residues (ATOM records): (download)

>d1js6a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa)}
mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdv
ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
wlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavl
eklvayasdqahssveragliggvklkaipsdgkfamrasalqealerdkaaglipffvv
atlgttsccsfdnllevgpicheediwlhvdaayagsaficpefrhllngvefadsfnfn
phkwllvnfdcsamwvkrrtdltgafksglitdyrhwqlplgrrfrslkmwfvfrmygvk
glqayirkhvqlshefeafvlqdprfevcaevtlglvcfrlkgsdglneallerinsark
ihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella

SCOP Domain Coordinates for d1js6a_:

Click to download the PDB-style file with coordinates for d1js6a_.
(The format of our PDB-style files is described here.)

Timeline for d1js6a_: