Lineage for d1js2d_ (1js2 D:)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) 
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) Protein HIPIP (high potential iron protein) [57654] (6 species) 
Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries) 
Domain d1js2d_: 1js2 D: [67214]
Details for d1js2d_
PDB Entry: 1js2 (more details), 1.9 Å
PDB Description: crystal structure of c77s hipip: a serine ligated [4fe-4s] cluster
SCOP Domain Sequences for d1js2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1js2d_ g.35.1.1 (D:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum)}
mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
tdewkgcqlfpgklinvngwsaswtlkag
SCOP Domain Coordinates for d1js2d_:
Click to download the PDB-style file with coordinates for d1js2d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1js2d_:
- d1js2d_ first appeared in SCOP 1.59
- d1js2d_ appears in SCOP 1.63
- d1js2d_ appears in the current release, SCOPe 2.08, called d1js2d1
View in 3D
