Lineage for d1js2d_ (1js2 D:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144530Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 144531Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 144532Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 144533Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 144534Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)
  8. 144541Domain d1js2d_: 1js2 D: [67214]

Details for d1js2d_

PDB Entry: 1js2 (more details), 1.9 Å

PDB Description: Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster

SCOP Domain Sequences for d1js2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js2d_ g.35.1.1 (D:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum)}
mefmsapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaaga
tdewkgcqlfpgklinvngwsaswtlkag

SCOP Domain Coordinates for d1js2d_:

Click to download the PDB-style file with coordinates for d1js2d_.
(The format of our PDB-style files is described here.)

Timeline for d1js2d_: